PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_017026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 367aa    MW: 39163.7 Da    PI: 8.8161
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_017026genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.61.5e-4277152176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +CqvegC++dls+ak y+ rhkvC +hsk+++v+vsg eqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  DCAR_017026  77 RCQVEGCKVDLSDAKGYYARHKVCVMHSKSSKVVVSGNEQRFCQQCSRFHNLPEFDQGKRSCRRRLAGHNERRRKP 152
                  6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.8E-3571139IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.16375152IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-4076156IPR004333Transcription factor, SBP-box
PfamPF031107.0E-3278151IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGSYSSSSTS SDSLNGLKFG QKIYFEDVGG AGGGGGNNSN KSGGSGSVSC SSAGDVAPAS  60
PAKKGRFAAA GGQQPPRCQV EGCKVDLSDA KGYYARHKVC VMHSKSSKVV VSGNEQRFCQ  120
QCSRFHNLPE FDQGKRSCRR RLAGHNERRR KPPPGSLLST RYGENSSGTG SFVMDFTSYP  180
RATWRDQWTP TRAFEQVAGN QNHEFGRFLP WQSNSESPQP EIQGSTNNNP SHGTNLSSGG  240
FFTGASDSSC ALSLLSRQPC NLKGQSSNLG SNYELDTDNC HMGSPTAVHG TNISHLPSGS  300
WDYKGNESGT STLHMLSDSS LGQLTQPGNR VYAGELQVNQ QSGRPSTSLE PSRAYYSSAH  360
NMHWST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31781511184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267898.11e-127promoter-binding protein SPL9
TrEMBLD6QZ291e-127D6QZ29_VITVI; Promoter-binding protein SPL9
STRINGVIT_08s0007g06270.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.14e-34squamosa promoter binding protein-like 9